Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppil3 Peptide - C-terminal region

Ppil3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Cyp10l

UniProt

Q812D3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ppil3 Rabbit Polyclonal Antibody (orb581289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783638

Preservative

Lyophilized powder

AA Sequence

HLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PARP2 (NM_005484) AAV Particle
RC223373A1V 250 µL

Human PARP2 (NM_005484) AAV Particle

Sign In for Pricing
View Details
GPR119 Polyclonal Antibody
MBS9413315-01 0.05 mL

GPR119 Polyclonal Antibody

Sign In for Pricing
View Details
GPR119 Polyclonal Antibody
MBS9413315-02 0.1 mL

GPR119 Polyclonal Antibody

Sign In for Pricing
View Details
GPR119 Polyclonal Antibody
MBS9413315-03 5x 0.1 mL

GPR119 Polyclonal Antibody

Sign In for Pricing
View Details
Human Forkhead box protein C2 (FOXC2) ELISA Kit
RK10859 96 Tests

Human Forkhead box protein C2 (FOXC2) ELISA Kit

Sign In for Pricing
View Details
SNX27 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV667150 1.0 µg DNA

SNX27 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details