Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fank1 Peptide - N-terminal region

Fank1 Peptide - N-terminal region

Product Specifications

UniProt

Q66H07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fank1 Rabbit Polyclonal Antibody (orb581323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008348

Preservative

Lyophilized powder

AA Sequence

RPHPPVVGKVTHHSIELYWDLEKREKRQGPQEQWLRFSIEEEDPKMHNYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexanoyl Glycine
TRC-H281200-250MG 250 mg

Hexanoyl Glycine

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF405S conjugate, 0.1mg/mL
BNC041798-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATF3 (NM_001030287) Human Over-expression Lysate
LY422248 100 µg

ATF3 (NM_001030287) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Lung: right upper lobe
CR562615 5 µg

Tissue Total RNA, Lung: right upper lobe

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD235 Antibody[HIR2]
E-AB-F1080G-01 20 Tests

PE/Cyanine5 Anti-Human CD235 Antibody[HIR2]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD235 Antibody[HIR2]
E-AB-F1080G-02 100 Tests

PE/Cyanine5 Anti-Human CD235 Antibody[HIR2]

Sign In for Pricing
View Details