Ak1 Peptide - middle region
Ak1 Peptide - middle region
Product Specifications
UniProt
P39069
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ak1 Rabbit Polyclonal Antibody (orb582506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_077325
Preservative
Lyophilized powder
AA Sequence
TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A09720-1-PE 100 µg/Vial
Anti-SLC7A3 Antibody Picoband® (PE Conjugate)
Sign In for Pricing
View Details 
MBS6500896-01 0.1 mL
STAT1, Phosphorylated (Ser727) (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84) (MaxLight 405)
Sign In for Pricing
View Details MBS6500896-02 5x 0.1 mL
STAT1, Phosphorylated (Ser727) (Signal Transducer And Activator Of Transcription 1-alpha/beta, Transcription Factor ISGF-3 Components p91/p84) (MaxLight 405)
Sign In for Pricing
View Details V2121-35-ML490 100 µL
Vascular Endothelial Growth Inhibitor (VEGI) (MaxLight 490) discontinued
Sign In for Pricing
View Details VD3N512 1 Each
Rabbit Anti-Mouse Glutathione S Transferase Mu 2 (GSTM2) Polyclonal Antibody
Sign In for Pricing
View Details