Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ak1 Peptide - middle region

Ak1 Peptide - middle region

Product Specifications

UniProt

P39069

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ak1 Rabbit Polyclonal Antibody (orb582506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077325

Preservative

Lyophilized powder

AA Sequence

TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human PRDM11 Antibody Fluoro594 Conjugated
DZ41385-Fluoro594 200 µL/Vial

Anti-Human PRDM11 Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details
Collagen Type XV (COL15) BioAssayTM ELISA Kit (Mouse)
024313 96 Tests

Collagen Type XV (COL15) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Sodium deoxycholate monohydrate
FD47400-01 25 g

Sodium deoxycholate monohydrate

Sign In for Pricing
View Details
Sodium deoxycholate monohydrate
FD47400-02 50 g

Sodium deoxycholate monohydrate

Sign In for Pricing
View Details
Sodium deoxycholate monohydrate
FD47400-03 100 g

Sodium deoxycholate monohydrate

Sign In for Pricing
View Details
Sodium deoxycholate monohydrate
FD47400-04 250 g

Sodium deoxycholate monohydrate

Sign In for Pricing
View Details