Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Camk2b Peptide - middle region

Camk2b Peptide - middle region

Product Specifications

Product Name Alternative

Ck2b

UniProt

Q63094

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Camk2b Rabbit Polyclonal Antibody (orb582725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035813

Preservative

Lyophilized powder

AA Sequence

DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HypoGel® 400 FP
SP400110150170.25G 25 g

HypoGel® 400 FP

Sign In for Pricing
View Details
4-(N-tert-Butoxycarbonyl)aminobenzoic Acid-d4
TRC-B690842-2.5MG 2.5 mg

4-(N-tert-Butoxycarbonyl)aminobenzoic Acid-d4

Sign In for Pricing
View Details
TRIB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B11]
TA805275AM 100 µL

TRIB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B11]

Sign In for Pricing
View Details
SUMO-2/3 (SM23/496), CF740 conjugate, 0.1mg/mL
BNC740496-500 1x 500 µL

SUMO-2/3 (SM23/496), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ccdc150 Mouse Gene Knockout Kit (CRISPR)
KN502668 1 Kit

Ccdc150 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Cytochrome C/CYCS Protein (His Tag)
PKSH032336-01 10 µg

Recombinant Human Cytochrome C/CYCS Protein (His Tag)

Sign In for Pricing
View Details