Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acin1 Peptide - C-terminal region

Acin1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610036I19Rik, 2610510L13Rik, Acinus, Acn, C79325, acinusL, acinusS, mKIAA0670

UniProt

Q52KR6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acin1 Rabbit Polyclonal Antibody (orb583934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229535

Preservative

Lyophilized powder

AA Sequence

RSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN5 Antibody
GWB-ML359H 50 µg

ZKSCAN5 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD43/Sialophorin Antibody (SPN/2049R) [Alexa Fluor 350]
NBP3-08244AF350 100 µL

Rabbit Monoclonal CD43/Sialophorin Antibody (SPN/2049R) [Alexa Fluor 350]

Sign In for Pricing
View Details
OR4B1 Antibody
MBS7118945-01 0.05 mg

OR4B1 Antibody

Sign In for Pricing
View Details
OR4B1 Antibody
MBS7118945-02 0.1 mg

OR4B1 Antibody

Sign In for Pricing
View Details
OR4B1 Antibody
MBS7118945-03 5x 0.1 mg

OR4B1 Antibody

Sign In for Pricing
View Details
Calcyclin (F-1) Alexa Fluor® 488
sc-271396 AF488 200 µg/mL

Calcyclin (F-1) Alexa Fluor® 488

Sign In for Pricing
View Details