Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acin1 Peptide - C-terminal region

Acin1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610036I19Rik, 2610510L13Rik, Acinus, Acn, C79325, acinusL, acinusS, mKIAA0670

UniProt

Q52KR6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acin1 Rabbit Polyclonal Antibody (orb583934) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229535

Preservative

Lyophilized powder

AA Sequence

RSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microphthalmia (Transcription Factor, MITF, MI, WS2A, bHLHe32) (APC)
MBS6426739-01 0.1 mL

Microphthalmia (Transcription Factor, MITF, MI, WS2A, bHLHe32) (APC)

Sign In for Pricing
View Details
Microphthalmia (Transcription Factor, MITF, MI, WS2A, bHLHe32) (APC)
MBS6426739-02 5x 0.1 mL

Microphthalmia (Transcription Factor, MITF, MI, WS2A, bHLHe32) (APC)

Sign In for Pricing
View Details
Human Serum Albumin Mouse Monoclonal Antibody
E10G20494 100 µL

Human Serum Albumin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Vipivotide tetraxetan (PSMA-617)
S8670-25mg 25 mg

Vipivotide tetraxetan (PSMA-617)

Sign In for Pricing
View Details
GPXP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
58341121 3x 1.0µg DNA

GPXP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
N- (3-Chlorophenyl) -4-hydrazinyl-3-nitrobenzene-1-sulfonamide
OR84672-01 100 mg

N- (3-Chlorophenyl) -4-hydrazinyl-3-nitrobenzene-1-sulfonamide

Sign In for Pricing
View Details