Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARS2 Peptide - N-terminal region

PARS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MT-PRORS

UniProt

Q7L3T8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARS2 Rabbit Polyclonal Antibody (orb586717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689481

Preservative

Lyophilized powder

AA Sequence

GGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horseradish Peroxidase Conjugated Rabbit Anti-LcH Antibody
HAL-1401-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Anti-LcH Antibody

Sign In for Pricing
View Details
B7-1 (CD80) Goat Polyclonal Antibody
AP23702PU-N 100 µg

B7-1 (CD80) Goat Polyclonal Antibody

Sign In for Pricing
View Details
HSD17B13 (NM_178135) Human Over-expression Lysate
LC440268 20 µg

HSD17B13 (NM_178135) Human Over-expression Lysate

Sign In for Pricing
View Details
TCN1 (NM_001062) Human Recombinant Protein
TP322285L 1 mg

TCN1 (NM_001062) Human Recombinant Protein

Sign In for Pricing
View Details
9130023H24Rik Mouse Gene Knockout Kit (CRISPR)
KN500509 1 Kit

9130023H24Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Bromovaleric acid
TRC-B689033-500MG 500 mg

2-Bromovaleric acid

Sign In for Pricing
View Details