Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARS2 Peptide - N-terminal region

PARS2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MT-PRORS

UniProt

Q7L3T8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARS2 Rabbit Polyclonal Antibody (orb586717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689481

Preservative

Lyophilized powder

AA Sequence

GGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p47-phox Mouse Monoclonal Antibody [A6B10]
HA600050 100 µL

p47-phox Mouse Monoclonal Antibody [A6B10]

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF488A conjugate, 0.1mg/mL
BNC882552-100 1x 100 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2 (LFA2/600), CF568 conjugate, 0.1mg/mL
BNC680600-100 1x 100 µL

CD2 (LFA2/600), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAP7D1 (NM_001286366) Human Tagged ORF Clone
RG239605 10 µg

MAP7D1 (NM_001286366) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL
BNC471577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(-)-Isopulegol
TRC-I874650-500G 500 g

(-)-Isopulegol

Sign In for Pricing
View Details