Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLFN5 Peptide - N-terminal region

SLFN5 Peptide - N-terminal region

Product Specifications

UniProt

Q08AF3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLFN5 Rabbit Polyclonal Antibody (orb326650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659412

Preservative

Lyophilized powder

AA Sequence

VDAGKVTLGTQQRQEMDPRLREKQNEIILRAVCALLNSGGGIIKAEIENK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS700399 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF594 conjugate, 0.1mg/mL
BNC941099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cnr1 Mouse Gene Knockout Kit (CRISPR)
KN503573 1 Kit

Cnr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RHAG (NM_000324) Human Over-expression Lysate
LY424797 100 µg

RHAG (NM_000324) Human Over-expression Lysate

Sign In for Pricing
View Details
PE/Cyanine5.5 Rat IgG2b, κ Isotype Control
RD22558F-01 25 µg

PE/Cyanine5.5 Rat IgG2b, κ Isotype Control

Sign In for Pricing
View Details
PE/Cyanine5.5 Rat IgG2b, κ Isotype Control
RD22558F-02 100 µg

PE/Cyanine5.5 Rat IgG2b, κ Isotype Control

Sign In for Pricing
View Details