Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLFN5 Peptide - N-terminal region

SLFN5 Peptide - N-terminal region

Product Specifications

UniProt

Q08AF3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLFN5 Rabbit Polyclonal Antibody (orb326650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659412

Preservative

Lyophilized powder

AA Sequence

VDAGKVTLGTQQRQEMDPRLREKQNEIILRAVCALLNSGGGIIKAEIENK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIP Polyclonal Antibody
E-AB-16169-01 20 µL

AIP Polyclonal Antibody

Sign In for Pricing
View Details
AIP Polyclonal Antibody
E-AB-16169-02 60 µL

AIP Polyclonal Antibody

Sign In for Pricing
View Details
AIP Polyclonal Antibody
E-AB-16169-03 120 µL

AIP Polyclonal Antibody

Sign In for Pricing
View Details
AIP Polyclonal Antibody
E-AB-16169-04 200 µL

AIP Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706312 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Rabbit Tumor Necrosis Factor Alpha (TNFa) ELISA Kit
RDR-TNFa-Rb-01 96 Tests

Rabbit Tumor Necrosis Factor Alpha (TNFa) ELISA Kit

Sign In for Pricing
View Details