MRPS7 Peptide - C-terminal region
MRPS7 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MRP-S, MRP-S7, RP-S7, RPMS7, S7mt, bMRP27a
UniProt
Q9Y2R9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPS7 Rabbit Polyclonal Antibody (orb586855) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057055
Preservative
Lyophilized powder
AA Sequence
QFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC473644-100 1x 100 µL
CD3e (T-Cell Marker) (rC3e/1931), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-M0065-01 5x 96 Tests
Uncoated Mouse IL-2 (Interleukin 2) ELISA Kit
Sign In for Pricing
View Details E-UNEL-M0065-02 15x 96 Tests
Uncoated Mouse IL-2 (Interleukin 2) ELISA Kit
Sign In for Pricing
View Details 