MRPS7 Peptide - C-terminal region
MRPS7 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MRP-S, MRP-S7, RP-S7, RPMS7, S7mt, bMRP27a
UniProt
Q9Y2R9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MRPS7 Rabbit Polyclonal Antibody (orb586855) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057055
Preservative
Lyophilized powder
AA Sequence
QFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI3G4]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908858/imageurl/cf810440.webp)
CF810440 100 µg
AFAP (AFAP1) Mouse Monoclonal Antibody [Clone ID: OTI3G4]
Sign In for Pricing
View Details 
LC422715 20 µg
TrkB (NTRK2) (NM_001018064) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC401794-500 1x 500 µL
CD45RB (B-Cell Marker) (N/A), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 