Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUBPL Peptide - C-terminal region

NUBPL Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf127, IND1, huInd1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUBPL Rabbit Polyclonal Antibody (orb586865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079428

Preservative

Lyophilized powder

AA Sequence

AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIBIN Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-16085R-BF594-TR 20 µL

FIBIN Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal p16INK4a/CDKN2A Antibody [Allophycocyanin]
NBP2-98881APC 0.1 mL

Rabbit Polyclonal p16INK4a/CDKN2A Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Recombinant Human Deoxyguanosine kinase, mitochondrial
MBS1447984-01 0.02 mg (Yeast)

Recombinant Human Deoxyguanosine kinase, mitochondrial

Sign In for Pricing
View Details
Recombinant Human Deoxyguanosine kinase, mitochondrial
MBS1447984-02 0.1 mg (Yeast)

Recombinant Human Deoxyguanosine kinase, mitochondrial

Sign In for Pricing
View Details
Recombinant Human Deoxyguanosine kinase, mitochondrial
MBS1447984-03 1 mg (Yeast)

Recombinant Human Deoxyguanosine kinase, mitochondrial

Sign In for Pricing
View Details
Recombinant Human Deoxyguanosine kinase, mitochondrial
MBS1447984-04 5x 1 mg (Yeast)

Recombinant Human Deoxyguanosine kinase, mitochondrial

Sign In for Pricing
View Details