Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUBPL Peptide - C-terminal region

NUBPL Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf127, IND1, huInd1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUBPL Rabbit Polyclonal Antibody (orb586865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079428

Preservative

Lyophilized powder

AA Sequence

AQTLGLEVLGDIPLHLNIREASDTGQPIVFSQPESDEAKAYLRIAVEVVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ring1A/RING1 Mouse mAb
E2221095 100 µL

Ring1A/RING1 Mouse mAb

Sign In for Pricing
View Details
Chorionic Gonadotropin, Human, beta (hCGb) (FITC)
C5069-87-FITC 100 µL

Chorionic Gonadotropin, Human, beta (hCGb) (FITC)

Sign In for Pricing
View Details
Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit
MBS9341050-01 48 Well

Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit

Sign In for Pricing
View Details
Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit
MBS9341050-02 96 Well

Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit

Sign In for Pricing
View Details
Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit
MBS9341050-03 5x 96 Well

Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit

Sign In for Pricing
View Details
Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit
MBS9341050-04 10x 96 Well

Mouse Thioredoxin-related transmembrane protein 2, TMX2 ELISA Kit

Sign In for Pricing
View Details