Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52A5 Peptide - C-terminal region

OR52A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-33

UniProt

Q9H2C5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52A5 Rabbit Polyclonal Antibody (orb586871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005160

Preservative

Lyophilized powder

AA Sequence

IRVNKIYGLFVAFAILGFDIIFITLSYVQIFITVFQLPQKEARFKAFNTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR (C-6His)
C954-50ug 50 µg

Recombinant Human Pyruvate Kinase, Liver And RBC/PKLR (C-6His)

Sign In for Pricing
View Details
ABCF1 (ATP-binding Cassette, Sub-family F, Member 1, ABC27, ABC50) (MaxLight 750)
MBS6405011-01 0.1 mL

ABCF1 (ATP-binding Cassette, Sub-family F, Member 1, ABC27, ABC50) (MaxLight 750)

Sign In for Pricing
View Details
ABCF1 (ATP-binding Cassette, Sub-family F, Member 1, ABC27, ABC50) (MaxLight 750)
MBS6405011-02 5x 0.1 mL

ABCF1 (ATP-binding Cassette, Sub-family F, Member 1, ABC27, ABC50) (MaxLight 750)

Sign In for Pricing
View Details
RBM5 antibody - N-terminal region
MBS3204219-01 0.1 mL

RBM5 antibody - N-terminal region

Sign In for Pricing
View Details
RBM5 antibody - N-terminal region
MBS3204219-02 5x 0.1 mL

RBM5 antibody - N-terminal region

Sign In for Pricing
View Details
MAO-B-IN-25
BA8510-5 5 mg

MAO-B-IN-25

Sign In for Pricing
View Details