Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52A5 Peptide - C-terminal region

OR52A5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-33

UniProt

Q9H2C5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52A5 Rabbit Polyclonal Antibody (orb586871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005160

Preservative

Lyophilized powder

AA Sequence

IRVNKIYGLFVAFAILGFDIIFITLSYVQIFITVFQLPQKEARFKAFNTC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Motilin (MTL) Rat ELISA Kit
F0956 96 Tests

Motilin (MTL) Rat ELISA Kit

Sign In for Pricing
View Details
Anti-MOCS1 Antibody Picoband
MBS1758840-01 0.01 mg

Anti-MOCS1 Antibody Picoband

Sign In for Pricing
View Details
Anti-MOCS1 Antibody Picoband
MBS1758840-02 0.1 mg (Carrier Free)

Anti-MOCS1 Antibody Picoband

Sign In for Pricing
View Details
Anti-MOCS1 Antibody Picoband
MBS1758840-03 0.1 mg

Anti-MOCS1 Antibody Picoband

Sign In for Pricing
View Details
Anti-MOCS1 Antibody Picoband
MBS1758840-04 0.1 mg (Cy3)

Anti-MOCS1 Antibody Picoband

Sign In for Pricing
View Details
Anti-MOCS1 Antibody Picoband
MBS1758840-05 0.1 mg (Biotin)

Anti-MOCS1 Antibody Picoband

Sign In for Pricing
View Details