PLEKHG3 Peptide - C-terminal region
PLEKHG3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ARHGEF43, KIAA0599
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLEKHG3 Rabbit Polyclonal Antibody (orb586883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056364
Preservative
Lyophilized powder
AA Sequence
PGGRPSARSPLSPTETFSWPDVRELCSKYASRDEARRAGGGRPRGPPVNR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-F692117-5MG 5 mg
2-(2-Formamidothiazol-4-yl)acetic Acid-13C,15N2
Sign In for Pricing
View Details ![Peripherin (PRPH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F4]](https://cdn.genprice.uk/products/937/6868c3d7994c49e6dc3ffa9d/imageurl/ta806181bm.webp)
TA806181BM 100 µL
Peripherin (PRPH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F4]
Sign In for Pricing
View Details 
BNC942040-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941971-100 1x 100 µL
LMO2 (B-Cell Marker) (LMO2/1971), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 