Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHG3 Peptide - C-terminal region

PLEKHG3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARHGEF43, KIAA0599

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHG3 Rabbit Polyclonal Antibody (orb586883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056364

Preservative

Lyophilized powder

AA Sequence

PGGRPSARSPLSPTETFSWPDVRELCSKYASRDEARRAGGGRPRGPPVNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS651148 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Tissue FFPE Sections, Parathyroid gland
CS808095 5x 5 µm

Tissue FFPE Sections, Parathyroid gland

Sign In for Pricing
View Details
Buthiobate
TRC-B999580-10MG 10 mg

Buthiobate

Sign In for Pricing
View Details
CRISP2 (NM_001142417) Human Over-expression Lysate
LC428079 20 µg

CRISP2 (NM_001142417) Human Over-expression Lysate

Sign In for Pricing
View Details
Strept. Avidin Peroxidase Colloidal Gold, 1mL 5nm
HGA-02-5 1 mL

Strept. Avidin Peroxidase Colloidal Gold, 1mL 5nm

Sign In for Pricing
View Details
Cholesteryl Hemisuccinate
TRC-C432586-5G 5 g

Cholesteryl Hemisuccinate

Sign In for Pricing
View Details