Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD14A Peptide - middle region

ABHD14A Peptide - middle region

Product Specifications

Product Name Alternative

DORZ1

UniProt

Q9BUJ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD14A Rabbit Polyclonal Antibody (orb586919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_056222

Preservative

Lyophilized powder

AA Sequence

DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nucleoporin p62 Antibody
RC-16325-01 50 μL

Recombinant Nucleoporin p62 Antibody

Sign In for Pricing
View Details
Recombinant Nucleoporin p62 Antibody
RC-16325-02 100 µL

Recombinant Nucleoporin p62 Antibody

Sign In for Pricing
View Details
Recombinant Nucleoporin p62 Antibody
RC-16325-03 1 mL

Recombinant Nucleoporin p62 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS804857 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Aggrecan Antibody (Biotin)
KB-7432-01 50 μL

Aggrecan Antibody (Biotin)

Sign In for Pricing
View Details
Aggrecan Antibody (Biotin)
KB-7432-02 100 µL

Aggrecan Antibody (Biotin)

Sign In for Pricing
View Details