Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD14A Peptide - middle region

ABHD14A Peptide - middle region

Product Specifications

Product Name Alternative

DORZ1

UniProt

Q9BUJ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABHD14A Rabbit Polyclonal Antibody (orb586919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_056222

Preservative

Lyophilized powder

AA Sequence

DLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Arachidoyl-sn-glycero-3-phosphocholine
TRC-A765095-25MG 25 mg

1-Arachidoyl-sn-glycero-3-phosphocholine

Sign In for Pricing
View Details
Human POLE2 activation kit by CRISPRa
GA103650 1 Kit

Human POLE2 activation kit by CRISPRa

Sign In for Pricing
View Details
Phenyl 4-Hydroxybenzoate
TRC-P335330-1G 1 g

Phenyl 4-Hydroxybenzoate

Sign In for Pricing
View Details
CDA Rabbit Polyclonal Antibody
TA374495 100 µL

CDA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF640R conjugate, 0.1mg/mL
BNC402432-500 1x 500 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF647 conjugate, 0.1mg/mL
BNC470763-500 1x 500 µL

CD34 (HPCA1/763), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details