Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM2A Peptide - C-terminal region

ACSM2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

A-923A4.1, ACSM2

UniProt

Q08AH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM2A Rabbit Polyclonal Antibody (orb586921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010845

Preservative

Lyophilized powder

AA Sequence

SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Slc38a6 shRNA (UAS) - Lentiviral mouse Slc38a6 shRNA (UAS, GFP) (100)
GTR15297372 1 Vial

Lentiviral mouse Slc38a6 shRNA (UAS) - Lentiviral mouse Slc38a6 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
SCOC Polyclonal Antibody, Biotin Conjugated
A63393-100 100 µL

SCOC Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CDKN1A Antibody
MBS7123501-01 0.05 mL

CDKN1A Antibody

Sign In for Pricing
View Details
CDKN1A Antibody
MBS7123501-02 0.1 mL

CDKN1A Antibody

Sign In for Pricing
View Details
CDKN1A Antibody
MBS7123501-03 5x 0.1 mL

CDKN1A Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IFI35 Antibody (OTI1C9) [mFluor Violet 500 SE]
NBP2-71004MFV500 0.1 mL

Mouse Monoclonal IFI35 Antibody (OTI1C9) [mFluor Violet 500 SE]

Sign In for Pricing
View Details