Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM2A Peptide - C-terminal region

ACSM2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

A-923A4.1, ACSM2

UniProt

Q08AH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM2A Rabbit Polyclonal Antibody (orb586921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010845

Preservative

Lyophilized powder

AA Sequence

SYKFPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETGLTCMVSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse AG-2 Protein
NBP2-59537-0.5mg 0.5 mg

Recombinant Mouse AG-2 Protein

Sign In for Pricing
View Details
Motesanib (AMG706) 10mM * 1mL in DMSO
A11496-10mM-D 10 mM x 1mL in DMSO

Motesanib (AMG706) 10mM * 1mL in DMSO

Sign In for Pricing
View Details
SMIM15 Protein Lysate
OCOA15084-20UG 20 µg

SMIM15 Protein Lysate

Sign In for Pricing
View Details
RPS6KB1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-1426R-PE-Cy7 100 µL

RPS6KB1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
B23, phosphorylated (Thr199) discontinued
533436-01 30ul

B23, phosphorylated (Thr199) discontinued

Sign In for Pricing
View Details
B23, phosphorylated (Thr199) discontinued
533436-02 100 µL

B23, phosphorylated (Thr199) discontinued

Sign In for Pricing
View Details