Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM4 Peptide - N-terminal region

ACSM4 Peptide - N-terminal region

Product Specifications

UniProt

P0C7M7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM4 Rabbit Polyclonal Antibody (orb586922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073923

Preservative

Lyophilized powder

AA Sequence

DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYVE1 (271-275) Rabbit Polyclonal Antibody
AP26047PU-N 100 µL

LYVE1 (271-275) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
8,10-Dihydroxy-cannabinol
TRC-D448803-5MG 5 mg

8,10-Dihydroxy-cannabinol

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-500 1x 500 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA Ligase I (LIG1) (N-term) Rabbit Polyclonal Antibody
AP52477PU-N 400 µL

DNA Ligase I (LIG1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560648 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
Recombinant Human LTBR/TNFRSF3 Protein (Fc Tag)
PKSH032718-01 10 µg

Recombinant Human LTBR/TNFRSF3 Protein (Fc Tag)

Sign In for Pricing
View Details