Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACSM4 Peptide - N-terminal region

ACSM4 Peptide - N-terminal region

Product Specifications

UniProt

P0C7M7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACSM4 Rabbit Polyclonal Antibody (orb586922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073923

Preservative

Lyophilized powder

AA Sequence

DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Styxl1 Mouse Gene Knockout Kit (CRISPR)
KN516945 1 Kit

Styxl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLEC16A Rabbit Polyclonal Antibody
AP17215PU-N 400 µL

CLEC16A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LTK Antibody
8C10512-AAT 50 µg

LTK Antibody

Sign In for Pricing
View Details
10X Tris Phosphate-EDTA (TPE), Ultra Pure Grade, 1L
PB1340-1L 1 L

10X Tris Phosphate-EDTA (TPE), Ultra Pure Grade, 1L

Sign In for Pricing
View Details
DMC1 (2H12/4), CF594 conjugate, 0.1mg/mL
BNC942178-500 1x 500 µL

DMC1 (2H12/4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF640R conjugate, 0.1mg/mL
BNC400597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details