Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1B15 Peptide - C-terminal region

AKR1B15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AKR1B10L

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR1B15 Rabbit Polyclonal Antibody (orb326701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074007

Preservative

Lyophilized powder

AA Sequence

TAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRARP Rabbit Polyclonal Antibody (HRP)
orb2719424 100 µg

SRARP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PR/SET Domain 1 (PRDM1) Antibody
abx430329 200 µL

PR/SET Domain 1 (PRDM1) Antibody

Sign In for Pricing
View Details
Mouse Mir155hg Pre-designed siRNA Set A
SI108499A 1 Each

Mouse Mir155hg Pre-designed siRNA Set A

Sign In for Pricing
View Details
Horse Glutamate Oxaloacetate Transaminase 1 (GOT1) ELISA Kit
MBS043686-01 48 Well

Horse Glutamate Oxaloacetate Transaminase 1 (GOT1) ELISA Kit

Sign In for Pricing
View Details
Horse Glutamate Oxaloacetate Transaminase 1 (GOT1) ELISA Kit
MBS043686-02 96 Well

Horse Glutamate Oxaloacetate Transaminase 1 (GOT1) ELISA Kit

Sign In for Pricing
View Details
Horse Glutamate Oxaloacetate Transaminase 1 (GOT1) ELISA Kit
MBS043686-03 5x 96 Well

Horse Glutamate Oxaloacetate Transaminase 1 (GOT1) ELISA Kit

Sign In for Pricing
View Details