Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C17orf108 Peptide - middle region

C17orf108 Peptide - middle region

Product Specifications

Product Name Alternative

HSD24, C17orf108

UniProt

A8MSI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C17orf108 Rabbit Polyclonal Antibody (orb326739) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001070148

Preservative

Lyophilized powder

AA Sequence

TKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWIMNKYKKQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Haze Meter BMET-1202
BMET-1202 1 Unit

Haze Meter BMET-1202

Sign In for Pricing
View Details
Recombinant OGG1 Antibody
RC-15620-01 50 μL

Recombinant OGG1 Antibody

Sign In for Pricing
View Details
Recombinant OGG1 Antibody
RC-15620-02 100 µL

Recombinant OGG1 Antibody

Sign In for Pricing
View Details
Recombinant OGG1 Antibody
RC-15620-03 1 mL

Recombinant OGG1 Antibody

Sign In for Pricing
View Details
Phenanthro[1,10-cd][1,2]dithiole
TRC-P295035-50MG 50 mg

Phenanthro[1,10-cd][1,2]dithiole

Sign In for Pricing
View Details
4930447C04Rik Mouse Gene Knockout Kit (CRISPR)
KN500367 1 Kit

4930447C04Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details