Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABS1 Peptide - N-terminal region

CABS1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C4orf35, CLPH, NYD-SP26

UniProt

Q96KC9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CABS1 Rabbit Polyclonal Antibody (orb326741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149113

Preservative

Lyophilized powder

AA Sequence

TTITSEGDHVTSVNEYMLESDFSTTTDNKLTAKKEKLKSEDDMGTDFIKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erlenmeyer Flasks
F4068 10 Plates/Pack

Erlenmeyer Flasks

Sign In for Pricing
View Details
ZNF273 Rabbit Polyclonal Antibody
TA383540 100 µL

ZNF273 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Apoa2 activation kit by CRISPRa
GA200237 1 Kit

Mouse Apoa2 activation kit by CRISPRa

Sign In for Pricing
View Details
rac Ibuprofen-d3
TRC-I140002-5MG 5 mg

rac Ibuprofen-d3

Sign In for Pricing
View Details
FLVCR2 (NM_001195283) Human Over-expression Lysate
LC434160 20 µg

FLVCR2 (NM_001195283) Human Over-expression Lysate

Sign In for Pricing
View Details
14-3-3 epsilon (YWHAE) (NM_006761) Human Over-expression Lysate
LC402021 20 µg

14-3-3 epsilon (YWHAE) (NM_006761) Human Over-expression Lysate

Sign In for Pricing
View Details