CABS1 Peptide - N-terminal region
CABS1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C4orf35, CLPH, NYD-SP26
UniProt
Q96KC9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CABS1 Rabbit Polyclonal Antibody (orb326741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149113
Preservative
Lyophilized powder
AA Sequence
TTITSEGDHVTSVNEYMLESDFSTTTDNKLTAKKEKLKSEDDMGTDFIKS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D232038-5MG 5 mg
3'-Deoxyadenosine 5’-Diphosphate Triethylamine Salt (>90%)
Sign In for Pricing
View Details 
BNC040183-500 1x 500 µL
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941422-100 1x 100 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC423267 20 µg
RPL21P44 (NM_001011538) Human Over-expression Lysate
Sign In for Pricing
View Details