Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALML6 Peptide - C-terminal region

CALML6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAGLP

UniProt

Q8TD86

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALML6 Rabbit Polyclonal Antibody (orb586953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619650

Preservative

Lyophilized powder

AA Sequence

YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRD2 (9C2) Monoclonal Antibody
bsm-51203M 100 µL

DRD2 (9C2) Monoclonal Antibody

Sign In for Pricing
View Details
Mucin 17 shRNA Plasmid (h)
sc-44612-SH 20 µg

Mucin 17 shRNA Plasmid (h)

Sign In for Pricing
View Details
Olfr1047 (m) -PR
sc-150240-PR 10 µM - 20 µL

Olfr1047 (m) -PR

Sign In for Pricing
View Details
Human ADRA1A / Alpha-1A adrenergic receptor Recombinant Protein
R1298h 1 Each

Human ADRA1A / Alpha-1A adrenergic receptor Recombinant Protein

Sign In for Pricing
View Details
Rac-trans Paroxetine-d4, Hydrochloride
P3112-25A 1 mg

Rac-trans Paroxetine-d4, Hydrochloride

Sign In for Pricing
View Details
SLN13, CT (SLFN13, Schlafen family member 13) (MaxLight 405)
MBS6348698-01 0.1 mL

SLN13, CT (SLFN13, Schlafen family member 13) (MaxLight 405)

Sign In for Pricing
View Details