Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALML6 Peptide - C-terminal region

CALML6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAGLP

UniProt

Q8TD86

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALML6 Rabbit Polyclonal Antibody (orb586953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619650

Preservative

Lyophilized powder

AA Sequence

YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Stat1 (Y701) Polyclonal Antibody
MBS2538690-01 0.02 mL

Phospho-Stat1 (Y701) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Stat1 (Y701) Polyclonal Antibody
MBS2538690-02 0.06 mL

Phospho-Stat1 (Y701) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Stat1 (Y701) Polyclonal Antibody
MBS2538690-03 0.12 mL

Phospho-Stat1 (Y701) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Stat1 (Y701) Polyclonal Antibody
MBS2538690-04 0.2 mL

Phospho-Stat1 (Y701) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Stat1 (Y701) Polyclonal Antibody
MBS2538690-05 5x 0.2 mL

Phospho-Stat1 (Y701) Polyclonal Antibody

Sign In for Pricing
View Details
Potassium Acetate
TRC-P698720-5G 5 g

Potassium Acetate

Sign In for Pricing
View Details