Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD2 Peptide - C-terminal region

CBWD2 Peptide - C-terminal region

Product Specifications

UniProt

Q8IUF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBWD2 Rabbit Polyclonal Antibody (orb326742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_742000

Preservative

Lyophilized powder

AA Sequence

DNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDDTERTNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CleanRNA™ eGFP-mRNA (low dsRNA)
N120012S 0.5 mg

CleanRNA™ eGFP-mRNA (low dsRNA)

Sign In for Pricing
View Details
MNAT1 Human Gene Knockout Kit (CRISPR)
KN401595 1 Kit

MNAT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lgals3bp Mouse Gene Knockout Kit (CRISPR)
KN309244RB 1 Kit

Lgals3bp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cfap58 Mouse Gene Knockout Kit (CRISPR)
KN502665 1 Kit

Cfap58 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-,  15nm
GP-7401-15 1 mL

Colloidal Gold Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-, 15nm

Sign In for Pricing
View Details
Polystyrene A OH
HA110000.5G 5 g

Polystyrene A OH

Sign In for Pricing
View Details