Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD2 Peptide - C-terminal region

CBWD2 Peptide - C-terminal region

Product Specifications

UniProt

Q8IUF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBWD2 Rabbit Polyclonal Antibody (orb326742) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_742000

Preservative

Lyophilized powder

AA Sequence

DNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDDTERTNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-
I-7401-1 1 mg

Ferritin Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-

Sign In for Pricing
View Details
Spata31d1d Mouse Gene Knockout Kit (CRISPR)
KN516557 1 Kit

Spata31d1d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF568 conjugate, 0.1mg/mL
BNC681284-500 1x 500 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF691 Human Gene Knockout Kit (CRISPR)
KN401673 1 Kit

ZNF691 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uridine 5'-Monophosphate
TRC-U830020-1G 1 g

Uridine 5'-Monophosphate

Sign In for Pricing
View Details
FFU (fan filter unit) BFSD-904
BFSD-904 1 Unit

FFU (fan filter unit) BFSD-904

Sign In for Pricing
View Details