Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC66 Peptide - N-terminal region

CCDC66 Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC66 Rabbit Polyclonal Antibody (orb326744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012524

Preservative

Lyophilized powder

AA Sequence

PLRTKTGHILKSTQDTCIGSEKLLQKKPVGSETSQAKGEKNGMTFSSTKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bersanlimab Antibody
orb1980517-01 1 mg

Bersanlimab Antibody

Sign In for Pricing
View Details
Bersanlimab Antibody
orb1980517-02 5 mg

Bersanlimab Antibody

Sign In for Pricing
View Details
Bersanlimab Antibody
orb1980517-03 10 mg

Bersanlimab Antibody

Sign In for Pricing
View Details
Bersanlimab Antibody
orb1980517-04 25 mg

Bersanlimab Antibody

Sign In for Pricing
View Details
Bersanlimab Antibody
orb1980517-05 50 mg

Bersanlimab Antibody

Sign In for Pricing
View Details
SLC5A6 Protein Vector (Mouse) (pPM-C-HA)
PV231176 500 ng

SLC5A6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details