Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300LB Peptide - middle region

CD300LB Peptide - middle region

Product Specifications

Product Name Alternative

CD300b, CLM-7, CLM7, CMRF35-A2, IREM-3, IREM3, TREM-5, TREM5

UniProt

A8K4G0

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD300LB Rabbit Polyclonal Antibody (orb586959) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777552

Preservative

Lyophilized powder

AA Sequence

CRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAT18 sgRNA CRISPR Lentivector set (Human)
K2527201 3x 1.0 µg

TRNAT18 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CIR2 Antibody
orb846030 2 mg

CIR2 Antibody

Sign In for Pricing
View Details
mmu-miR-6954-3p miRNA Antagomir
MNM02657 2x 5.0 nmol

mmu-miR-6954-3p miRNA Antagomir

Sign In for Pricing
View Details
Chicken TBCC domain containing protein 1 (TBCCD1) ELISA Kit
GTR10335118 96 Well

Chicken TBCC domain containing protein 1 (TBCCD1) ELISA Kit

Sign In for Pricing
View Details
Equine PAI2 ELISA Kit
EF012673 96 Tests

Equine PAI2 ELISA Kit

Sign In for Pricing
View Details
LRIG1 HDR Plasmid (h)
sc-403210-HDR 20 µg

LRIG1 HDR Plasmid (h)

Sign In for Pricing
View Details