Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4F Peptide - C-terminal region

CLEC4F Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLECSF13, KCLR

UniProt

Q8N1N0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC4F Rabbit Polyclonal Antibody (orb586961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775806

Preservative

Lyophilized powder

AA Sequence

LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLIG2 Rabbit Polyclonal Antibody
TA379462 100 µL

OLIG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 Rabbit Polyclonal Antibody
AP02739PU-N 100 µL

BRCA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Palladin Antibody
KC-1189-01 50 μL

Palladin Antibody

Sign In for Pricing
View Details
Palladin Antibody
KC-1189-02 100 µL

Palladin Antibody

Sign In for Pricing
View Details
Palladin Antibody
KC-1189-03 1 mL

Palladin Antibody

Sign In for Pricing
View Details
ST2 (IL1RL1) (NM_003856) Human Recombinant Protein
TP700261 20 µg

ST2 (IL1RL1) (NM_003856) Human Recombinant Protein

Sign In for Pricing
View Details