Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4F Peptide - C-terminal region

CLEC4F Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLECSF13, KCLR

UniProt

Q8N1N0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC4F Rabbit Polyclonal Antibody (orb586961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775806

Preservative

Lyophilized powder

AA Sequence

LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD134, Mouse (OX40) (OX-86), CF488A conjugate, 0.1mg/mL
BNC882004-500 1x 500 µL

CD134, Mouse (OX40) (OX-86), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF488A conjugate, 0.1mg/mL
BNC881660-100 1x 100 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF405S conjugate, 0.1mg/mL
BNC043803-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SATB1 Recombinant Rabbit Monoclonal Antibody [SP05-03]
ET1604-10 100 µL

SATB1 Recombinant Rabbit Monoclonal Antibody [SP05-03]

Sign In for Pricing
View Details
Ethyl 3-oxo-2-Phenylpropanoate (>90%)
TRC-B441355-10MG 10 mg

Ethyl 3-oxo-2-Phenylpropanoate (>90%)

Sign In for Pricing
View Details
Deacetamidine Cyano Dabigatran Ethyl Ester-13C6
TRC-D195651-25MG 25 mg

Deacetamidine Cyano Dabigatran Ethyl Ester-13C6

Sign In for Pricing
View Details