Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNIH2 Peptide - N-terminal region

CNIH2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CNIH-2, Cnil

UniProt

Q6PI25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNIH2 Rabbit Polyclonal Antibody (orb586964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872359

Preservative

Lyophilized powder

AA Sequence

AFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS530685 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
USE1 (Vesicle Transport Protein USE1, MDS032, p31, Putative MAPK-activating Protein PM26, SLT1, USE1-like Protein, USE1L) (PE)
135138-PE 100 µL

USE1 (Vesicle Transport Protein USE1, MDS032, p31, Putative MAPK-activating Protein PM26, SLT1, USE1-like Protein, USE1L) (PE)

Sign In for Pricing
View Details
Recombinant Mouse Leptin/LEP Protein
RP02880-01 100 μg

Recombinant Mouse Leptin/LEP Protein

Sign In for Pricing
View Details
Recombinant Mouse Leptin/LEP Protein
RP02880-02 500 μg

Recombinant Mouse Leptin/LEP Protein

Sign In for Pricing
View Details
Recombinant Mouse Leptin/LEP Protein
RP02880-03 1000 μg

Recombinant Mouse Leptin/LEP Protein

Sign In for Pricing
View Details
Mouse Trypsin Antibody ELISA Kit
MBS029475-01 48 Well

Mouse Trypsin Antibody ELISA Kit

Sign In for Pricing
View Details