Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNIH2 Peptide - N-terminal region

CNIH2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CNIH-2, Cnil

UniProt

Q6PI25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNIH2 Rabbit Polyclonal Antibody (orb586964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872359

Preservative

Lyophilized powder

AA Sequence

AFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND3P6 AAV Vector (Human) (CMV)
30992101 1 µg

MTND3P6 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Phf6 (NM_001290546) Mouse Untagged Clone
MC226782 10 µg

Phf6 (NM_001290546) Mouse Untagged Clone

Sign In for Pricing
View Details
Duox1 (NM_153739) Rat Untagged Clone
RN203031 10 µg

Duox1 (NM_153739) Rat Untagged Clone

Sign In for Pricing
View Details
CRELD1 Rabbit Polyclonal Antibody
TA371305 100 µL

CRELD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(3-bromo-2-fluorophenyl) boronic acid
JH269756 1 Each

(3-bromo-2-fluorophenyl) boronic acid

Sign In for Pricing
View Details
Recombinant Bordetella Petrii atpB Protein (aa 1-293)
VAng-Lsx2690-inquire Inquire

Recombinant Bordetella Petrii atpB Protein (aa 1-293)

Sign In for Pricing
View Details