CXorf36 Peptide - C-terminal region
CXorf36 Peptide - C-terminal region
Product Specifications
Product Name Alternative
4930578C19Rik, DIA1R, EPQL1862, PRO3743, bA435K1.1
UniProt
Q9H7Y0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CXorf36 Rabbit Polyclonal Antibody (orb586973) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_789789
Preservative
Lyophilized powder
AA Sequence
DKQEGSQEANRAGENKDIFSCLVSGCQAQLPSCESISEKQSLVLVCQKLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041815-500 1x 500 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details