CXorf36 Peptide - N-terminal region
CXorf36 Peptide - N-terminal region
Product Specifications
Product Name Alternative
4930578C19Rik, DIA1R, EPQL1862, PRO3743, bA435K1.1
UniProt
Q9H7Y0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CXorf36 Rabbit Polyclonal Antibody (orb586974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_789789
Preservative
Lyophilized powder
AA Sequence
GLDKCNACIGTSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
