CXorf56 Peptide - C-terminal region
CXorf56 Peptide - C-terminal region
Product Specifications
UniProt
Q9H5V9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CXorf56 Rabbit Polyclonal Antibody (orb586975) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071384
Preservative
Lyophilized powder
AA Sequence
VTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041815-500 1x 500 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details