Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF12L2 Peptide - N-terminal region

DCAF12L2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR40C

UniProt

Q5VW00

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCAF12L2 Rabbit Polyclonal Antibody (orb326752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013650

Preservative

Lyophilized powder

AA Sequence

KAPAVEAGAGSSSSQGLAAADGEGPLLPKKQKRPATRRRLVHYLKGREVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti Pig Igg1 Monoclonal Antibody
DMABT-52033MP 2 ml

Mouse Anti Pig Igg1 Monoclonal Antibody

Sign In for Pricing
View Details
Human Profilin 4 (PFN4) (NM_199346) AAV Particle
RC206327A1V 250 µL

Human Profilin 4 (PFN4) (NM_199346) AAV Particle

Sign In for Pricing
View Details
Ube2d3 3'UTR Lenti-reporter-Luc Vector
48958084 1.0 µg

Ube2d3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Olr816 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7177302 1.0 µg DNA

Olr816 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
BBX Knockout jurkat Polyclonal Cells
ARG33986 1 Million

BBX Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Human Melanin concenting hormone receptor 1 (MCHR1) ELISA kit
GTR10379475 96 Well

Human Melanin concenting hormone receptor 1 (MCHR1) ELISA kit

Sign In for Pricing
View Details