Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPY19L3 Peptide - C-terminal region

DPY19L3 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZPD9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPY19L3 Rabbit Polyclonal Antibody (orb586985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997208

Preservative

Lyophilized powder

AA Sequence

TNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFL8 Protein Vector (Mouse) (pPM-C-HA)
PV174772 500 ng

EGFL8 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
6- (Benzyloxy) -5H,6H,7H-pyrazolo[3,2-b][1,3]oxazine-3-carboxylic acid
QID14885-01 50 mg

6- (Benzyloxy) -5H,6H,7H-pyrazolo[3,2-b][1,3]oxazine-3-carboxylic acid

Sign In for Pricing
View Details
6- (Benzyloxy) -5H,6H,7H-pyrazolo[3,2-b][1,3]oxazine-3-carboxylic acid
QID14885-02 0.5 g

6- (Benzyloxy) -5H,6H,7H-pyrazolo[3,2-b][1,3]oxazine-3-carboxylic acid

Sign In for Pricing
View Details
GRB7 (Growth Factor Receptor-bound Protein 7) (Biotin)
MBS6419183-01 0.1 mL

GRB7 (Growth Factor Receptor-bound Protein 7) (Biotin)

Sign In for Pricing
View Details
GRB7 (Growth Factor Receptor-bound Protein 7) (Biotin)
MBS6419183-02 5x 0.1 mL

GRB7 (Growth Factor Receptor-bound Protein 7) (Biotin)

Sign In for Pricing
View Details
TPRKB Mouse Monoclonal Antibody [Clone ID: LBI1E9]
AMM14467VCF 100 µg

TPRKB Mouse Monoclonal Antibody [Clone ID: LBI1E9]

Sign In for Pricing
View Details