Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPY19L3 Peptide - C-terminal region

DPY19L3 Peptide - C-terminal region

Product Specifications

UniProt

Q6ZPD9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPY19L3 Rabbit Polyclonal Antibody (orb586985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997208

Preservative

Lyophilized powder

AA Sequence

TNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Illicium parviflorum Cytochrome b559 subunit beta (psbF), partial
MBS7089270 Inquire

Recombinant Illicium parviflorum Cytochrome b559 subunit beta (psbF), partial

Sign In for Pricing
View Details
RDX, CT (RDX, Radixin) (MaxLight 550) discontinued
040937-ML550 100 µL

RDX, CT (RDX, Radixin) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Apolipoprotein A-I (Apo A-I) discontinued
A2299-26A 100 µL

Apolipoprotein A-I (Apo A-I) discontinued

Sign In for Pricing
View Details
Monoacylglycerol Lipase (MGLL) CytoSection
TS418358P5 25 Slides

Monoacylglycerol Lipase (MGLL) CytoSection

Sign In for Pricing
View Details
PDLIM3 Protein Vector (Mouse) (pPM-C-HA)
PV214816 500 ng

PDLIM3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Minpp1 3'UTR GFP Stable Cell Line
TU163210 1.0 mL

Minpp1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details