Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS4L Peptide - middle region

DUS4L Peptide - middle region

Product Specifications

Product Name Alternative

DUS4, PP35

UniProt

O95620

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUS4L Rabbit Polyclonal Antibody (orb586989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_853559

Preservative

Lyophilized powder

AA Sequence

ETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrinogen gamma chain Antibody, RBITC Conjugated
bs-6895R-RBITC-TR 20 µL

Fibrinogen gamma chain Antibody, RBITC Conjugated

Sign In for Pricing
View Details
AccuFectTM Transfection Reagent
K-7920 1 Each

AccuFectTM Transfection Reagent

Sign In for Pricing
View Details
Poly ADP-Ribose Polymerase 2 (PARP2) Antibody
abx433093 200 µL

Poly ADP-Ribose Polymerase 2 (PARP2) Antibody

Sign In for Pricing
View Details
Glutathione Hydrolase 1 Proenzyme (GGT1) Antibody
abx323820-01 50 µg

Glutathione Hydrolase 1 Proenzyme (GGT1) Antibody

Sign In for Pricing
View Details
Glutathione Hydrolase 1 Proenzyme (GGT1) Antibody
abx323820-02 100 µg

Glutathione Hydrolase 1 Proenzyme (GGT1) Antibody

Sign In for Pricing
View Details
Chicken Agmatinase, Mitochondrial (AGMAT) ELISA Kit
abx516803 96 Tests

Chicken Agmatinase, Mitochondrial (AGMAT) ELISA Kit

Sign In for Pricing
View Details