DUS4L Peptide - middle region
DUS4L Peptide - middle region
Product Specifications
Product Name Alternative
DUS4, PP35
UniProt
O95620
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUS4L Rabbit Polyclonal Antibody (orb586989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_853559
Preservative
Lyophilized powder
AA Sequence
ETPGFSVSIKIRIHDDLKRTVDLCQKAEATGVSWITVHGRTAEERHQPVH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6648706 1.0 µg DNA
Kbtbd7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
MBS6157429-01 0.1 mL
DERL1 (Degradation In Endoplasmic Reticulum Protein 1, DERtrin-1, Der1-like Protein 1, Derlin-1, DER1, UNQ243/PRO276, FLJ13784, FLJ42092, MGC3067, PRO2577) (PE)
Sign In for Pricing
View Details MBS6157429-02 5x 0.1 mL
DERL1 (Degradation In Endoplasmic Reticulum Protein 1, DERtrin-1, Der1-like Protein 1, Derlin-1, DER1, UNQ243/PRO276, FLJ13784, FLJ42092, MGC3067, PRO2577) (PE)
Sign In for Pricing
View Details