Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS15L1 Peptide - C-terminal region

EPS15L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EPS15R

UniProt

Q9UBC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPS15L1 Rabbit Polyclonal Antibody (orb586992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067058

Preservative

Lyophilized powder

AA Sequence

GFSDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein
TP325196L 1 mg

MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein

Sign In for Pricing
View Details
Colloidal Gold Conjugated Anguilla anguilla Lectin (Fresh Water Eel) -AAA-,  10nm
GP-4901-10 1 mL

Colloidal Gold Conjugated Anguilla anguilla Lectin (Fresh Water Eel) -AAA-, 10nm

Sign In for Pricing
View Details
STAT3 Rabbit Polyclonal Antibody
AP20998PU-N 100 µg

STAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3e Mouse Monoclonal Antibody (SK7), CF®405S Conjugate - Biotium Choice
P002-405S-125 1x 125 µL

CD3e Mouse Monoclonal Antibody (SK7), CF®405S Conjugate - Biotium Choice

Sign In for Pricing
View Details
Nostrin Mouse Gene Knockout Kit (CRISPR)
KN311123RB 1 Kit

Nostrin Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) S1 protein (HV69-70del), His Tag
S1N-C52Hd-100ug 100 µg

SARS-CoV-2 (COVID-19) S1 protein (HV69-70del), His Tag

Sign In for Pricing
View Details