Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS15L1 Peptide - C-terminal region

EPS15L1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EPS15R

UniProt

Q9UBC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPS15L1 Rabbit Polyclonal Antibody (orb586992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067058

Preservative

Lyophilized powder

AA Sequence

GFSDDPFKSKQDTPALPPKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(2,6-Dichlorophenyl)-4'-iodo-[1,1'-biphenyl]-4-amine
TRC-D436360-25MG 25 mg

N-(2,6-Dichlorophenyl)-4'-iodo-[1,1'-biphenyl]-4-amine

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), CF647 conjugate, 0.1mg/mL
BNC470144-100 1x 100 µL

Borrelia burgdorferi (p41 Flagellin) (6802), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMG5 Rabbit Polyclonal Antibody
TA381778 100 µL

SMG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNF-alpha (Tumor Necrosis Factor alpha), CF594 conjugate, 0.1mg/mL
BNC941674-100 1x 100 µL

TNF-alpha (Tumor Necrosis Factor alpha), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATP citrate lyase Recombinant Rabbit monoclonal Antibody
HA750171 100 µL

ATP citrate lyase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TentaGel® MB Br
MB160001.100G 100 g

TentaGel® MB Br

Sign In for Pricing
View Details