Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXD2 Peptide - middle region

EXD2 Peptide - middle region

Product Specifications

Product Name Alternative

C14orf114, EXDL2

UniProt

Q9NVH0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXD2 Rabbit Polyclonal Antibody (orb586995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060669

Preservative

Lyophilized powder

AA Sequence

NGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Homo sapiens Autophagy-related protein 16-1
MBS9422774-01 0.02 mg

Recombinant Homo sapiens Autophagy-related protein 16-1

Sign In for Pricing
View Details
Recombinant Homo sapiens Autophagy-related protein 16-1
MBS9422774-02 0.1 mg

Recombinant Homo sapiens Autophagy-related protein 16-1

Sign In for Pricing
View Details
Recombinant Homo sapiens Autophagy-related protein 16-1
MBS9422774-03 1 mg

Recombinant Homo sapiens Autophagy-related protein 16-1

Sign In for Pricing
View Details
Recombinant Homo sapiens Autophagy-related protein 16-1
MBS9422774-04 5x 1 mg

Recombinant Homo sapiens Autophagy-related protein 16-1

Sign In for Pricing
View Details
Src Polyclonal Antibody
RA21257-01 50 µL

Src Polyclonal Antibody

Sign In for Pricing
View Details
Src Polyclonal Antibody
RA21257-02 100 µL

Src Polyclonal Antibody

Sign In for Pricing
View Details