Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF5 Peptide - N-terminal region

ATF5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ATFX, HMFN0395

UniProt

Q9Y2D1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATF5 Rabbit Polyclonal Antibody (orb329589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036200

Preservative

Lyophilized powder

AA Sequence

MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SuLT1A1 (NM_001055) Human Over-expression Lysate
LY420735 100 µg

SuLT1A1 (NM_001055) Human Over-expression Lysate

Sign In for Pricing
View Details
Snrpn Mouse Gene Knockout Kit (CRISPR)
KN516411 1 Kit

Snrpn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF740 conjugate, 0.1mg/mL
BNC741857-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant BCKDK Antibody
RC-5626-01 50 μL

Recombinant BCKDK Antibody

Sign In for Pricing
View Details
Recombinant BCKDK Antibody
RC-5626-02 100 µL

Recombinant BCKDK Antibody

Sign In for Pricing
View Details
Recombinant BCKDK Antibody
RC-5626-03 1 mL

Recombinant BCKDK Antibody

Sign In for Pricing
View Details